How is VIP prepared and handled in a research setting?

Reconstitute with bacteriostatic water prior to use. Supplied as lyophilised material for laboratory research only — not for human use. Store sealed, cool, dry and away from light.

What should researchers know before working with VIP?

For research purposes only. Not for human consumption.

Pre-order & save10%→ ships 15 Oct Any 3 vials→10% off Any 6 vials→15% off Any 9 vials→20% off Free GHK-Cu 50 mgR399with selected vials Free GHK-Cu 100 mgR749with selected vials

Research Axes · 22 Goals

Shop by Goal

Start from what you want to change rather than from a compound name. Every goal below opens a full vertical — what the research points to, what we stock for it, and how to run it.

Browse all goals →

Health & Longevity

Systemic wellness — the compounds most studied for how you age, recover overnight and feel day to day.

Performance & Repair

Training, recovery and tissue-repair research — for getting back to the gym, the field or the trail sooner.

By Concern

Start from what you want to change — skin, hair, focus, mood, libido — and see what research points to.

Who It’s For

Curated entry points for specific researchers — women, veterinary work, first-timers and bulk buyers.

HPLC tested · Janoshik · Janoshik Certificates · Nationwide Delivery

Dossier LWL-VIPBatch VIP-2610AResearch use only

Pre-order · save 10% · ships 15 Oct

VIP 10mg

Name: VIP 10mg
Brand: Living Water Labs
SKU: VIP-2610A
Price: 959 ZAR
Availability: PreOrder

HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2

Vasoactive intestinal peptide, a 28-amino-acid neuropeptide — 10 mg lyophilised powder per vial.

R863R959Pre-order −10%

Earn R43 in points · 5% back as store credit

BAC3 ml incl.

Quantity

Dispatch15-Oct

Pre-order now and save 10% — new stock lands 15 Oct

Pre-orders are 10% off. Guaranteed dispatch on Thu 15 Oct: pay now and your order ships first that day.

Or just notify me when it lands

Restocking · next batch incoming

Be first when VIP lands

We’ll email you once — the moment it’s back. No marketing, no sharing.

Delivery estimate

See your dispatch day and arrival dates before you order.

Same R130 courier anywhere in SA · free over R2,500 · PUDO lockers R130.

HPLC TestedJanoshik CoAFast Shipping

Quality passport

VIP 10mg

Certificate available on request

Batch: VIP-2610A
Certificate: Request CoASent on WhatsApp
Form: LyophilisedSealed vial
Net content: 10mg
Per mg: R95.9per mg
Stocked in: South AfricaNo customs wait
Dispatch: On restockNotify-me above
Supplied for: Research useNot for human use

LWL-VIP · VIP-2610A

Request CoA Certificate library

Not sure? Find your research path Five questions, about a minute. Matched to the outcome you are researching.

01Research profile

Where the literature concentrates

Research profile

VIP

Metabolic

Published research on metabolic

VIP. Little published research addresses this area for this compound.

VIPRepair & gut

Metabolic1/10

Metabolic1
Satiety1
Body Comp1
Repair5
Skin & Hair2
Gut & Immune8
Cognition4
Mood3
Sleep4
Longevity4

Scores summarise published research, most of it laboratory and animal work. They describe what has been studied, not results in people. For research use only.

Evidence profile

Preliminary

Human clinical
Human observational
Animal models
Cell / in vitro
Mechanistic

Well-characterised receptor biology; human data are limited to small trials of the drug form (aviptadil).

Grades describe how much of each kind of research exists, not what a compound does. Conservative by design.

Cited findings

Intestinal protection
VIP promoted intestinal secretory-cell differentiation and reduced radiation-induced intestinal injury in models.
MouseStem Cell Res Ther 2024 · PMID 39380035 ↗
Tendon-repair models
VIP-loaded nanoparticles supported immune modulation and stem-cell function in tendon-repair research.
AnimalACS Nano 2025 · PMID 40184556 ↗
CNS and inflammation
Reviewed with PACAP for its biology in central nervous system and inflammatory disorders.
ReviewCurr Opin Endocrinol Diabetes Obes 2021 · PMID 33481421 ↗

Key literature

Animal research

Reviews

Cited literature — 4 peer-reviewed studies on VIP →

02Overview

What VIP is

A 28-amino-acid neuropeptide that bridges the nervous, digestive and immune systems through the VPAC receptors.

Each vial contains 10mg of lyophilised VIP, supplied as a sterile powder for reconstitution. Vasoactive intestinal peptide (VIP) is a 28-amino-acid neuropeptide of the secretin/glucagon family. It acts through the VPAC1 and VPAC2 receptors, which it shares with PACAP, and is studied for its roles in smooth-muscle relaxation, intestinal secretion, immune-cell regulation and neuroprotection. Recent laboratory work has examined VIP in radiation-induced intestinal injury and, loaded on nanoparticles, in tendon-repair models; the VIPoma syndrome illustrates the physiology of excess VIP. It holds no registration as a medicine in South Africa in this form and is supplied here strictly as research material. Findings described are from published laboratory, animal and clinical-research literature and are not statements about outcomes for any reader.

Mechanism, as studied

VIP signals through VPAC1 and VPAC2 receptors on smooth muscle, epithelium, neurons and immune cells.

STEP 01Binds VPAC1 / VPAC2 G-protein-coupled receptors
STEP 02Raises cAMP in target cells
STEP 03Relaxes smooth muscle and stimulates intestinal secretion
STEP 04Shifts immune cells towards an anti-inflammatory profile

Also known as

VIPVasoactive intestinal peptideVasoactive intestinal polypeptideAviptadil

03Specification

Product specification

Product	VIP
Identity	HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Size	10mg
Form	Lyophilised powder, sealed vial
Mol. weight	3325.8 g/mol
Batch	VIP-2610A
Price per mg	R95.9 / mg
Included	3 ml bacteriostatic water
Storage	Store at −20 °C in a dry, sealed environmentReconstitute with bacteriostatic water; use within 30 days at 4 °C · Avoid repeated freeze–thaw cycles
Supplied for	Laboratory research onlyNot for human or veterinary use

What arrives in your box

Six things, every order

Packed in South Africa, dispatched on business days, tracked to your door.

Your research compound
Sealed, lyophilised vial, exactly as listed: compound and strength on the label.
Batch identification
The batch number printed on the vial ties it to its certificate.
Certificate access
Certificate of analysis on request, sent on WhatsApp.
BAC water included
One 3 ml bacteriostatic water vial per peptide vial, at no charge.
Protective packaging
Padded, discreet outer box. No product names on the outside.
Courier tracking
The Courier Guy waybill is emailed the day it leaves us.

For laboratory research use only. Not for human or veterinary use.

04Certificate of analysis

Tested by Janoshik

Certificate of analysis

Each certificate is an independent Janoshik Analytical report naming the compound and its HPLC purity. Certificates we have not yet published are available on request.

Batch	VIP-2610A
Mol. weight	3325.8 g/mol

Every purity certificate we publish → We have not published one for VIP yet — ask us for it on WhatsApp 076 680 0306 / 072 926 7667.

Look up any batch certificate →

05Questions

Before you order

01What purity standard do your peptides meet?

Quality is documented by independent Janoshik Analytical reports (compound identity and HPLC purity) linked from each product page, with unpublished certificates available on request. Each Certificate of Analysis names the compound and reports its HPLC purity; published certificates are at livingwaterlabs.co.za/verify and any other is sent on request.

02Do you provide Certificates of Analysis?

Yes. Our certificates are independent Janoshik Analytical reports naming the compound and its HPLC purity. Published certificates are readable at livingwaterlabs.co.za/verify; for a compound not yet listed there, ask us on WhatsApp and we send it before you order.

03How should research peptides be stored upon receipt?

Peptides should be stored at -20°C in a sealed, dry environment. Once reconstituted, solutions should be stored at 4°C and used within 30 days, or aliquoted and stored at -80°C for longer-term stability. Avoid repeated freeze-thaw cycles.

04How long does delivery take in South Africa?

Orders are packed and dispatched within 1–2 business days and delivered door-to-door by tracked courier anywhere in South Africa. A tracking number is emailed to you when the courier collects. Standard courier is R130.

05What payment methods do you accept?

We accept EFT bank transfer. Banking details are provided at checkout. Please use your order reference number as payment reference so your order can be processed promptly.

06What does "for research purposes only" mean?

It means every product supplied by Living Water Labs is sold as a research chemical for laboratory and scientific investigation only, and is not supplied for human or veterinary use, not for the diagnosis or treatment of any condition, and not as a food, cosmetic or medicine. Living Water Labs is not a pharmacy, makes no medical or therapeutic claims about any product, and does not provide human dosing, treatment protocols, diagnosis or disease recommendations. What we do provide — identity, purity, certificates, literature, molecular data, reconstitution maths, handling and storage — is listed at livingwaterlabs.co.za/faq#research-use. Buyers confirm legitimate research intent at the point of order.

All questions →

Research support