Research Overview
HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Vasoactive intestinal peptide (VIP) is a 28-amino-acid neuropeptide of the secretin/glucagon family.
VIP (HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2) is a research-grade peptide supplied by Living Water Labs for laboratory investigation. Vasoactive intestinal peptide, a 28-amino-acid neuropeptide — 10 mg lyophilised powder per vial.. Each published certificate is an independent Janoshik Analytical report naming the compound and its HPLC purity; certificates not yet published can be requested. The summary below outlines documented mechanisms and study areas reported in the research literature.
Scientific name
HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Molecular weight
3325.8 g/mol
Vial size
10mg
Vasoactive intestinal peptide (VIP) is a 28-amino-acid neuropeptide of the secretin/glucagon family. Acting through the VPAC1 and VPAC2 receptors (shared with PACAP) it relaxes smooth muscle, stimulates intestinal secretion and regulates immune-cell function, and it is studied as a neuroprotective and anti-inflammatory signal.
Curr Opin Endocrinol Diabetes Obes · 2021
Reviews VIP/PACAP receptor biology in CNS and inflammatory disorders.
View on PubMed (PMID 33481421)Stem Cell Res Ther · 2024
In models, VIP promoted intestinal secretory-cell differentiation and reduced radiation injury.
View on PubMed (PMID 39380035)ACS Nano · 2025
Studied VIP-loaded nanoparticles for immune modulation and stem-cell support in tendon repair models.
View on PubMed (PMID 40184556)Pancreas · 2019
Reviews VIPomas, whose excess VIP causes a watery-diarrhoea syndrome.
View on PubMed (PMID 31609932)Citations describe findings reported in the referenced preclinical, in-vitro or clinical literature. They are provided for research and educational purposes only and are not a therapeutic claim.
All information is provided for research and educational purposes only and describes findings in preclinical/in-vitro literature. Not medical advice. Products are supplied strictly for research purposes — not for human consumption.
Keep exploring — goal collections, plain-language guides and the wellness journal, all in one place.
RESEARCH BY GOAL
GUIDES & TOOLS
Step-by-step guides — reconstitution, dosing, storage, handling and CoAs.
Explore →Work out exact bacteriostatic-water volumes for any vial — a free lab tool.
Explore →Per-compound overviews: documented mechanisms, study areas and cited literature.
Explore →Independent Janoshik Analytical certificates — compound identity and HPLC purity — published as styled summaries, the rest on request.
Explore →Purity, CoAs, storage, shipping and ordering — answered.
Explore →PEPTIDE GLOSSARY
Third-party lab documentation confirming a batch’s identity and purity.
Explore →High-performance liquid chromatography — the assay behind the purity figure on every published certificate.
Explore →Dissolving a lyophilised peptide in bacteriostatic water to a target concentration.
Explore →Freeze-dried to a stable powder for cold, dark, long-term storage.
Explore →Sterile water with 0.9% benzyl alcohol, used to reconstitute peptides.
Explore →Supplied strictly for laboratory research — not for human consumption.
Explore →FROM THE WELLNESS JOURNAL
7 min read · Peptides, Metabolic
Explore →2 min read · Peptides, Cognitive
Explore →9 min read · Peptides, Metabolic
Explore →Start from what you want to change rather than from a compound name. Every goal below opens a full vertical — what the research points to, what we stock for it, and how to run it.
Systemic wellness — the compounds most studied for how you age, recover overnight and feel day to day.
Training, recovery and tissue-repair research — for getting back to the gym, the field or the trail sooner.
Start from what you want to change — skin, hair, focus, mood, libido — and see what research points to.
Curated entry points for specific researchers — women, veterinary work, first-timers and bulk buyers.